PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G69560.1
Common NameATMYB105, F10D13.19, F24J1.31, LOF2, MYB105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 330aa    MW: 38440.1 Da    PI: 7.3098
Description myb domain protein 105
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G69560.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-16107152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
      AT1G69560.1 107 RGHWRPAEDTKLKELVAVYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 152
                      899*****************************.***********996 PP

2Myb_DNA-binding59.19.6e-19159202146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
      AT1G69560.1 159 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 202
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.637102153IPR017930Myb domain
SuperFamilySSF466895.99E-29105200IPR009057Homeodomain-like
SMARTSM007177.5E-14106155IPR001005SANT/Myb domain
PfamPF002495.2E-16107152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-26108160IPR009057Homeodomain-like
CDDcd001672.09E-12110151No hitNo description
PROSITE profilePS5129427.112154208IPR017930Myb domain
SMARTSM007174.1E-15158206IPR001005SANT/Myb domain
PfamPF002491.3E-15159201IPR001005SANT/Myb domain
CDDcd001678.04E-12161201No hitNo description
Gene3DG3DSA:1.10.10.601.5E-21161207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEMVHADVAS LSITPCFPSS LSSSSHHHYN QQQHCIMSED QHHSMDQTTS SDYFSLNIDN  60
AQHLRSYYTS HREEDMNPNL SDYSNCNKKD TTVYRSCGHS SKASVSRGHW RPAEDTKLKE  120
LVAVYGPQNW NLIAEKLQGR SGKSCRLRWF NQLDPRINRR AFTEEEEERL MQAHRLYGNK  180
WAMIARLFPG RTDNSVKNHW HVIMARKFRE QSSSYRRRKT MVSLKPLINP NPHIFNDFDP  240
TRLALTHLAS SDHKQLMLPV PCFPGYDHEN ESPLMVDMFE TQMMVGDYIA WTQEATTFDF  300
LNQTGKSEIF ERINEEKKPP FFDFLGLGTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-331052085108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.147330.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306978870.0
Genevisible259833_at0.0
Expression AtlasAT1G69560-
AtGenExpressAT1G69560-
ATTED-IIAT1G69560-
Functional Description ? help Back to Top
Source Description
TAIREncodes LOF2 (LATERAL ORGAN FUSION2), a MYB-domain transcription factor expressed in organ boundaries. Functions in boundary specification, meristem initiation and maintenance, and organ patterning. Also see LOF1 (At1g26780).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G69560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G69560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493080.0AF249308.1 Arabidopsis thaliana putative transcription factor (MYB105) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177115.10.0MYB-domain transcription factor LOF2
TrEMBLQ9SEZ40.0Q9SEZ4_ARATH; MYB-domain transcription factor LOF2
STRINGAT1G69560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Alves-Ferreira M, et al.
    Global expression profiling applied to the analysis of Arabidopsis stamen development.
    Plant Physiol., 2007. 145(3): p. 747-62
    [PMID:17905860]
  4. Lee DK,Geisler M,Springer PS
    LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis.
    Development, 2009. 136(14): p. 2423-32
    [PMID:19542355]
  5. Naz AA, et al.
    Trifoliate encodes an MYB transcription factor that modulates leaf and shoot architecture in tomato.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(6): p. 2401-6
    [PMID:23341595]